DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and RGD1564786

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:374 Identity:107/374 - (28%)
Similarity:185/374 - (49%) Gaps:15/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNK---SEVAKQH 79
            ||..||:.|.:::.. |:..|.....||::::.|||.|.:|.::...:.|...|.   .:| .||
  Rat    53 FAIKLFKVLGEDISK-NVFFSLPSISSALSMILMGANGTTASQICQAMSLDKCNSIGGGDV-HQH 115

  Fly    80 AESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-PEDSVKKVNK 143
            ..|...:.:.......||....:::.:..:|...|.|...:.:.||...|::.. ||.|.:.:|.
  Rat   116 FLSLLTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSRQHINT 180

  Fly   144 WLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMR 208
            |:.|.|...:|.|..|...||::.:.|||.::|:....|.|.:..|:...|.::..::..|.||.
  Rat   181 WVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTVQMMS 245

  Fly   209 QIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLM--KE 271
            |...|:....|.:.:|:|.||||.|.|:|...:|.:.....:||.:|......|...:..|  ||
  Rat   246 QKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLENELTYDKFLEWTDEDTMEEKE 310

  Fly   272 VDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCE 336
            ::|.:|:.::|.:.|:...|:|:|:...|:..:||.|.: ..|....:|:..||.|:.::|.|.|
  Rat   311 MEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGI-SSKHGLFLSKVVHKSFVEMSEEGTE 374

  Fly   337 VAPEAEVQPEVLKKNP-DRKFFKADRPFVFAIRD--RKNVYFVGHFVKP 382
            .|...:|   |..|:| ..:...||.||:|:|:|  .|.:.|:|.|..|
  Rat   375 AAAPTDV---VTMKSPLTPRCLIADHPFLFSIQDTRSKEILFLGRFSSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 105/369 (28%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 106/372 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.