DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb13

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:391 Identity:111/391 - (28%)
Similarity:196/391 - (50%) Gaps:22/391 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLI----LGVS 70
            |||.:...|..:||:.|| :....|:..||.|..:|:.::.:|..|.:|.||:..|.    .|.|
  Rat     3 SLSTATTHFLFDLFKELN-KTSDGNVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTGSS 66

  Fly    71 ---------NKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEA 126
                     .|:|......:....|.|...|...|.:..|||..........:.|...::::|..
  Rat    67 RLKSEEKEIEKTEEIHHQFQKLLTEISKPTKDYDLIISNRLYGERTYLFLQKYIDYVEKYYHASL 131

  Fly   127 YSLNYLNPED-SVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQ 190
            ..::::|..| |.||:|.|:|..|...|::||.....||.:.::|:|:::|:..|::.|.::.|:
  Rat   132 EPVDFVNAADESRKKINSWVESQTNEKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTK 196

  Fly   191 IDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKL 255
            .:|||:|......|.||.|...|.:...:.|:::|:.:|::.|:.:|.::||..||||.::.:||
  Rat   197 EEDFWLNKNISKPVQMMAQCSSFSFTLLEDLQAKIVGIPYKNSDFSMFVLLPNDIDGLEKIIDKL 261

  Fly   256 GQLDMNEVAAKSLMKE--VDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQK 318
            ....:.|..:...:|:  ||:.:|:.::|.|.||:..|:.:||:|.| :..||.|.: ...:..:
  Rat   262 SPEKLVEWTSPGQLKQRKVDLRLPRLKVEETYDLQPTLEAVGIHSAF-SEHADYSGM-SAHSGLQ 324

  Fly   319 ISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVK 381
            .....|:.||.|||.|.|......|..:||.. ...:....:.||:|.:|.|:  ::.|.|.|..
  Rat   325 TQNFLHRSFLVVTEEGVEATAGTGVGFKVLSA-ASCELVHCNHPFLFFVRHRESDSILFFGRFSS 388

  Fly   382 P 382
            |
  Rat   389 P 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 106/378 (28%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 109/388 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.