DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb3

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:390 Identity:108/390 - (27%)
Similarity:193/390 - (49%) Gaps:38/390 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            |...|:|.|.|...  |:..||....:|:.::.:||.|.:..::...|.|..:.|....|. |:|
  Rat    11 FTLELYRQLRDSED--NIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKPKEKS-ADS 72

  Fly    83 WTDE------------CSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-P 134
            ..:|            .:.:.....|:....:|..:.......|.:...:::.|...||::.: .
  Rat    73 HDEENVHEQFRKIMNQLNKSNGAYDLKSPNSIYGAKGFPFLQTFMEDIKKYYQANVESLDFAHAA 137

  Fly   135 EDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPR 199
            |:|.||:|.|:|..|...:::||.....||.:.::|||:::|:.:||..|.:|.|:.|.||:|..
  Rat   138 EESQKKINSWVENKTNGKIKDLFPRGSLNSSTILVLVNAVYFKGQWNHKFDEQRTREDKFWLNKN 202

  Fly   200 QRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVA 264
            ....|.||||..:|.:...:.::::::::|::...|:|.|:||..||||.:|||||        :
  Rat   203 TSKPVQMMRQTNEFNFIFLEDVQAKMVEIPYKGKELSMFILLPMEIDGLKKLEEKL--------S 259

  Fly   265 AKSL----------MKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKI 319
            |.:|          |.::::::|:|:::...||..||:.||:...|:..:||.|.:...| ...:
  Rat   260 ADTLLAWTSPKNMRMTQLNLSLPRFKVQEKYDLPGPLEHMGMVDAFNPQKADFSGMSSTK-GLVV 323

  Fly   320 SEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIR--DRKNVYFVGHFVKP 382
            |:..||.||.|.|.|.|.|....|:..:|.. |....|..:|||:..|:  :..::.|.|....|
  Rat   324 SKVLHKSFLEVNEEGAEAAAATGVETRILSA-PRTTEFTCNRPFIVFIKPNNTNSILFFGRVSSP 387

  Fly   383  382
              Rat   388  387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 107/385 (28%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.