DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and LOC299282

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:395 Identity:101/395 - (25%)
Similarity:189/395 - (47%) Gaps:48/395 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            :|::|...||.:|::.|....|..|::.||....:|:|::.:||...:.:|:...|..   |.:|
  Rat    44 TLASSNTDFALSLYKKLALRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLKF---NLTE 105

  Fly    75 VAKQHAES----WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPE 135
            :.::....    .....|..:..|.:...:.|::::|:.|.::|.:.....:.|||:..::..|.
  Rat   106 ITEEEIHQGFGHLLQRLSQPEDQVEINTGSALFIDKEQPILSEFQEKTRALYQAEAFIADFKQPN 170

  Fly   136 DSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQ 200
            ::.|.:|.::...|...:..||:.  ....:|::|||.|.|:.||...|....|...:|:::.::
  Rat   171 EAKKLINDYVSNQTQGKIAELFSD--LEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKR 233

  Fly   201 RMEVSMMRQIGQFR--YGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMN-- 261
            .::|.||: |.:..  |...::|...:|:|.: ..|.:.:.|||.        :.|:.|::.:  
  Rat   234 SVKVPMMK-IKEVTTPYVRDEELSCSVLELKY-TGNASALFILPD--------QGKMQQVESSLQ 288

  Fly   262 -EVAAK---SLMKEV--DVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLS------DLFEMK 314
             |...|   ||:..:  |:.:|||.|.....||..|.::||..|| :.|||||      ||:   
  Rat   289 PETLKKWKDSLIPRIINDLRMPKFSISTDYSLKEVLPELGIKKVF-SQQADLSRITGTKDLY--- 349

  Fly   315 TPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI--RDRKNVYFVG 377
                :|:..||..|:|.|.|.| |..|.....|:::.|  :....:|||:..|  .|.:::.||.
  Rat   350 ----VSQVVHKAVLDVDETGTE-ATAATGVATVIRRQP--RTLNFNRPFMVVITDMDSQSILFVA 407

  Fly   378 HFVKP 382
            ....|
  Rat   408 KITNP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 98/382 (26%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 101/395 (26%)
RCL 365..389 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.