DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina3m

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:404 Identity:94/404 - (23%)
Similarity:186/404 - (46%) Gaps:52/404 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTTAPSLSASPI--VFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLIL 67
            ||...||:...|  .||.:|::.|..:.|..|::.||....:|:.:|.:||.|.:.:|:...|..
  Rat    39 GTQLDSLTLESINTDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRF 103

  Fly    68 GVSNKSEVAKQHAESWTDEC---------SCAKKGVALRLVT--RLYVNEEEKIRTDFNDMALEF 121
            .::          ||:..:.         ..::.|..::::|  .|::::..::..:|.:.....
  Rat   104 NLT----------ESYETDIHQGFGHLLQRLSQPGDQVKIITGNALFIDKNLQVLAEFQEKTRAL 158

  Fly   122 FNAEAYSLNYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQ 186
            :..||::.::..|..:.|.:|.::...|...::.|.:.  ....:|::|||.|.||.||...|..
  Rat   159 YQVEAFTADFQQPRVTEKLINDYVRNQTQGKIQELVSG--LKERTSMVLVNYLLFRGKWKVPFDP 221

  Fly   187 QLTQIDDFWINPRQRMEVSMMRQIGQFR--YGESKKLKSQILQLPFERSNLTMMIILPTAIDGLP 249
            ..|...:|:::.::.::||||: |.:..  |...::|...:|:|.: ..|.:.:.|||.. ..:.
  Rat   222 DYTFESEFYVDEKRSVKVSMMK-IEELTTPYFRDEELSCSVLELKY-TGNSSALFILPDK-GRMQ 283

  Fly   250 ELEEKLGQLDMNEVAAKSLMKEVD-VTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEM 313
            ::|..|....:.:.......:::| :.:|:..|.....|:..|.::||..|| :.|||||.:...
  Rat   284 QVEASLQPETLKKWKDSLRPRKIDELYLPRLSISTDYSLEEVLPELGIRDVF-SQQADLSRITGA 347

  Fly   314 KTPQKISEARHKVFLNVTEFGCEVA--------PEAEVQPEVLKKNPDRKFFKADRPFVFAIRDR 370
            | ...:|:..|||.|:|.|.|.|.|        |.:...|.::..|         |||:.|:...
  Rat   348 K-DLSVSQVVHKVVLDVNETGTEAAAATGANLVPRSGRPPMIVWFN---------RPFLIAVSHT 402

  Fly   371 --KNVYFVGHFVKP 382
              :.:.|:...:.|
  Rat   403 HGQTILFMAKVINP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 88/384 (23%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 86/385 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.