DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina6

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:376 Identity:92/376 - (24%)
Similarity:174/376 - (46%) Gaps:44/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEV 75
            |:.:.:.||.||::.|....|..|.::||.....|:.:|.:|:.     :.:|...||. |.:|.
  Rat    34 LAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSA-----QTQSLQSLGF-NLTET 92

  Fly    76 AKQHAESWTDECSCAKK----GVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPED 136
            ::..........:...|    |:.:.:...:::.::.|::..|.....:::.:||.::::.:...
  Rat    93 SEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTK 157

  Fly   137 SVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQR 201
            :.:::|:.::..|...:.::|:.  .:|.:|.||||.:|.|..|...|..:.|:.:||::|....
  Rat   158 ASQQINQHVKDKTQGKIEHVFSD--LDSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETST 220

  Fly   202 MEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAK 266
            ::|.||.|.|...|........|::|:.:. .|.|...|||..           ||:| ..:||.
  Rat   221 VKVPMMVQSGSIGYFRDSVFPCQLIQMDYV-GNGTAFFILPDQ-----------GQMD-TVIAAL 272

  Fly   267 S---------LM--KEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKIS 320
            |         ||  ::|::.||||.|..|.|||..|:.:.|..:. ..|:|.|...: ..|..::
  Rat   273 SRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLL-TNQSDFSGNTK-DVPLTLT 335

  Fly   321 EARHKVFLNVTEFGCEVAPEAEVQPEVLKKNP-DRKFFKADRPFVFAIRDR 370
            .. ||..|.:.| |..:.......|..|:..| |.||   ::||:..:.|:
  Rat   336 MV-HKAMLQLDE-GNVLPNSTNGAPLHLRSEPLDIKF---NKPFILLLFDK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 91/369 (25%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 91/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.