DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serping1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:412 Identity:90/412 - (21%)
Similarity:182/412 - (44%) Gaps:94/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALN-DEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKS 73
            :||.:...|:..|:.|.: .:....||..||....|.:|.|.:|||..:...|...|        
  Rat   146 TLSEALTDFSVKLYHAFSATKKAETNMAFSPFSIASLLTQVLLGAGDSTKSNLEDIL-------- 202

  Fly    74 EVAKQHAESWTDECSC--------AKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLN 130
                    |:..:.:|        :.|||.  .|::::.:.:..||..:.:.:|..:.:   |..
  Rat   203 --------SYPKDFACVHQTLKAFSSKGVT--SVSQIFHSPDLAIRDTYVNASLSLYGS---SPR 254

  Fly   131 YLNPED--SVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDD 193
            .|.|:.  ::|.:|.|:.::|.:.:..|.  :...||:.::|:|:::..|||.|.|.|:......
  Rat   255 VLGPDGDANLKLINTWVAENTNHKINELL--DSLPSDTRLVLLNAVYLSAKWKKTFEQKKMMASF 317

  Fly   194 FWINPRQRMEVSMMRQIGQFRYGESKK----------LKSQILQLPFERSNLTMMIILP-TAIDG 247
            .:.|  ..::|.|:         .|||          ||:::.||.... ||:.:|::| :....
  Rat   318 LYKN--SMIKVPML---------SSKKYPLALFNDQTLKAKVGQLQLSH-NLSFVIMVPQSPTHQ 370

  Fly   248 LPELEEKLGQLDMNEVAAKSLMKEVD--------VTIPKFRIECTVDLKVPLQKMGINSVFD--- 301
            |.::|:.|     |....|:::|:::        |.:|:.:::.:.|:...::|:   ..||   
  Rat   371 LEDMEKAL-----NPTVFKAILKKLELSKFQPTYVMMPRIKVKSSQDMLSIMEKL---EFFDFTY 427

  Fly   302 ----AGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRP 362
                .|..:..||       ::|..:|:..|.:||.|.|.|..:.:.   :.:|  ...|:..:|
  Rat   428 DLNLCGLTEDPDL-------QVSSMKHETVLELTETGVEAAAASTIS---VARN--LLIFEVQQP 480

  Fly   363 FVFAIRDRKNVY--FVGHFVKP 382
            |:|.:.|:::.:  |:|....|
  Rat   481 FLFLLWDQRHKFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 87/399 (22%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 87/403 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.