DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb1a

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001026812.1 Gene:Serpinb1a / 291091 RGDID:1306203 Length:379 Species:Rattus norvegicus


Alignment Length:402 Identity:115/402 - (28%)
Similarity:197/402 - (49%) Gaps:56/402 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEV 75
            ||::..:||..||..|::..|..|:..||....||:.:||:|..|.:|.:| ||..    :...|
  Rat     4 LSSANSLFALELFHTLSESSPTGNIFFSPFSISSALAMVFLGTKGTTAAQL-SKTF----HFDSV 63

  Fly    76 AKQHAESWTDECSCAKKGVA--LRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-PEDS 137
            ...|:...:.....:|:|.:  |:|..|||..:......:|.....:.:.|:...:::.: .||:
  Rat    64 EDVHSRFQSLNAEVSKRGASHTLKLANRLYGEKTYNFLPEFLTSTQKMYGADLAPVDFQHASEDA 128

  Fly   138 VKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRM 202
            .|::|:|::..|...:..|....|.:|.:.::|||:::|:..|.:.|.:|.|....|.:|.:...
  Rat   129 RKEINQWVKGQTEGKIPELLAVGVVDSMTKLVLVNAIYFKGMWEEKFMKQDTTDAPFRLNKKNTK 193

  Fly   203 EVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAID----GLPELEEKLGQLDMNEV 263
            .|.||.|..:|.:|....||.::|::|::...|:|:|:||..|:    ||.::||::....:.|.
  Rat   194 SVKMMYQKKKFFFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQITLEKLREW 258

  Fly   264 AAKSLMKEVD--VTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLS------DLFEMKTPQKIS 320
            ..:..::.:|  |.:|:|:||.:..|...|.::|:..:|::.:||||      |||       ||
  Rat   259 TKRENLENIDVHVKLPRFKIEESYILNSNLGRLGLQDLFNSSKADLSGMSGSRDLF-------IS 316

  Fly   321 EARHKVFLNVTEFGCEVA-------------PEAEVQPEVLKKNPDRKFFKADRPFVFAIRDR-- 370
            :..||.|:.|.|.|.|.|             ||.|              |.||.||:|.||..  
  Rat   317 KIVHKAFVEVNEEGTEAAAATAGIATFCMLLPEEE--------------FTADHPFIFFIRHNPT 367

  Fly   371 KNVYFVGHFVKP 382
            .||.|:|....|
  Rat   368 ANVLFLGRVCSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 112/390 (29%)
Serpinb1aNP_001026812.1 SERPIN 4..379 CDD:294093 114/400 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.