DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:396 Identity:104/396 - (26%)
Similarity:192/396 - (48%) Gaps:42/396 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKS 73
            |.|.|: ..||..:.|.|.:: ...|:..||....|:::::.:||.|.:|.::...|.|...|.:
  Rat     3 PLLEAN-ATFALKVLRVLGED-SSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGN 65

  Fly    74 EVAKQHA--ESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-PE 135
            .....|.  :|...|.:.:.:...|:....::|.:..:|...|.|...:|:.||..::::.. ||
  Rat    66 GGGDFHQCFQSLLTEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPE 130

  Fly   136 DSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQ 200
            .|.:.:|.|:.|.|...:|.|.:|...||::.::|:||.:|:..|.|.|.::.|:...|.::..:
  Rat   131 QSRQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNE 195

  Fly   201 RMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAA 265
            :..|.||.....||....:.:.:.:..||:..:.|::.|:||.....|..:|        |::..
  Rat   196 KKIVQMMFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVE--------NQITY 252

  Fly   266 KSLM----------KEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKIS 320
            :.|:          :||::.:|:|::|.:.|:|..|.|:|:.:.|:.|:||.|.: ..|....:|
  Rat   253 EKLIEWTRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGI-SSKPGLFLS 316

  Fly   321 EARHKVFLNVTEFGCEVAPEAEV-------QPEVLKKNPDRKFFKADRPFVFAIRDRKN--VYFV 376
            :..||..:.|.|.|.|.|...|:       .|:.|         .||.||:|.|:|.:|  :.|:
  Rat   317 KVVHKSVVEVNEEGTEAAAPTEIVTMGSPLSPQCL---------VADHPFLFLIQDDRNKAILFL 372

  Fly   377 GHFVKP 382
            |.|..|
  Rat   373 GRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 99/382 (26%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.