DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinf2

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:387 Identity:95/387 - (24%)
Similarity:178/387 - (45%) Gaps:29/387 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGGTTAPS--LSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKL 65
            |..||..:  ||.:.:.|..:||..:.......|:::||.....|::.:.:||..::.:.|:..|
  Rat    72 SAPTTEETRRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVL 136

  Fly    66 ILGVSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLN 130
            .:.:.:.......|.      |.....| .:||..|:|:.:...|:.||.:.:.:.|.|:...|.
  Rat   137 HMNMGSCIPHLLSHF------CQNLNPG-TIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLT 194

  Fly   131 YLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSV-ILVNSLFFRAKWNKIFPQQLTQIDDF 194
            ....|| :..:|||:::.|...:.: |..|:  .|::| :|:|::.|...|...|...|||.|.|
  Rat   195 GRQEED-LMNINKWVKEATEGKIED-FLSEL--PDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSF 255

  Fly   195 WINPRQRMEVSMMR-QIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQL 258
            .::.:..:.|:||. |....|:...::.:.|:...||: :|::.::|:||....  .:.|.|..|
  Rat   256 HLDEQFTVPVAMMHAQSYPLRWFLLEQPEIQVAHFPFQ-NNMSFVVIMPTYFGW--NVSEVLANL 317

  Fly   259 DMNEVAAKSLM-KEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEA 322
            ..:.:...|:. |...|.:||..:|..:||...|.|:|:..:|.:  .||..:.:...  .:|..
  Rat   318 TWDTLYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLFQS--PDLRGISDQSL--VVSSV 378

  Fly   323 RHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
            :|:..:.::|.|.|.|.....   .:.:.....|| .:|||:|.|.:..  ...|||....|
  Rat   379 QHQSTMELSEAGVEAAAATST---AMTRMSLSSFF-LNRPFIFFIMEETIGIPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 89/365 (24%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 91/372 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.