DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinf1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:407 Identity:84/407 - (20%)
Similarity:174/407 - (42%) Gaps:42/407 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGGTTAPSLSASPIV--------------------FARNLFRALNDEVPPVNMMVSPAGARSAM 46
            :|..:.||..:..|:|                    |..:|:|..:..|...|:::||....:|:
  Rat    25 SSQDSPAPDSTGEPVVEEDDPFFKAPVNKLAAAVSNFGYDLYRLRSGAVSTGNILLSPLSVATAL 89

  Fly    47 TLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIR 111
            :.:.:||..::...:...|...:.|..::...:.|......:..|.   .:..:|:....:.:::
  Rat    90 SALSLGAEQRTESVIHRALYYDLINNPDIHSTYKELLASVTAPEKN---FKSASRIVFERKLRVK 151

  Fly   112 TDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFF 176
            :.|.....:.:......|.. ||...::::|.|::......:..  :.....|..|::|:...:|
  Rat   152 SSFVAPLEKSYGTRPRILTG-NPRIDLQEINNWVQAQMKGKIAR--STREMPSALSILLLGVAYF 213

  Fly   177 RAKWNKIFPQQLTQIDDFWINPRQRMEVSMM---RQIGQFRYGESKKLKSQILQLPFERSNLTMM 238
            :.:|...|..:.|.:.||.::..:.:.|.||   :.|  .|||....|..:|.|||...| ::::
  Rat   214 KGQWATKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAI--LRYGLDSDLNCKIAQLPLTGS-MSII 275

  Fly   239 IILP-TAIDGLPELEEKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDA 302
            ..|| |....|..:||.|....::::..:....:..:|:||.::....|:...||.|.:.|:|::
  Rat   276 FFLPLTVTQNLTMIEESLTSEFVHDIDRELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLFES 340

  Fly   303 GQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI 367
              .|.|.:  ...|.|:::..|:......|.|...:...::||..|....|   :..:|||:|.:
  Rat   341 --PDFSKI--TGKPVKLTQVEHRAAFEWNEEGAGTSSNPDLQPVRLTFPLD---YHLNRPFIFVL 398

  Fly   368 RDRKN--VYFVGHFVKP 382
            ||...  :.|:|..:.|
  Rat   399 RDTDTGALLFIGRILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 78/366 (21%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 79/390 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.