DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and AT2G35555

DIOPT Version :10

Sequence 1:NP_610633.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001323897.1 Gene:AT2G35555 / 28718328 AraportID:AT2G35555 Length:122 Species:Arabidopsis thaliana


Alignment Length:76 Identity:18/76 - (23%)
Similarity:31/76 - (40%) Gaps:23/76 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 LQKMGINSVFDAGQADL----SDLFEMKTPQ-------KISEAR------------HKVFLNVTE 332
            |:::.....|..|:.|:    :|:.|:|.|:       :.|||.            ||..:.|.|
plant     2 LERLASTRGFLNGKEDIPSHWADVGELKIPRFKFDFGFEASEALKGLGLEVPSTIIHKSCIEVDE 66

  Fly   333 FGCEVAPEAEV 343
            .|.:.|..|.:
plant    67 VGSKAAAAAVI 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_610633.1 serpin42Dd-like_insects 13..382 CDD:381070 18/76 (24%)
AT2G35555NP_001323897.1 serpin <1..89 CDD:476815 18/76 (24%)

Return to query results.
Submit another query.