DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA11

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001073920.1 Gene:SERPINA11 / 256394 HGNCID:19193 Length:422 Species:Homo sapiens


Alignment Length:389 Identity:101/389 - (25%)
Similarity:187/389 - (48%) Gaps:50/389 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLIL-GVS-NKSEVAK--- 77
            ||..|::.|..:.|. |:..||....:.:.|:.:||...:     |.||| |:. |.:|..:   
Human    57 FALRLYKELAADAPG-NIFFSPVSISTTLALLSLGAQANT-----SALILEGLGFNLTETPEADI 115

  Fly    78 -QHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKV 141
             |...|.....:.....:.|::...|::::..|.|..:.|...|.:.|.|:|.|:.:...:.:::
Human   116 HQGFRSLLHTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTGRQI 180

  Fly   142 NKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQ-IDDFWINPRQRMEVS 205
            |.:|.:.|:..|.:.. || |:.|:.::|.|.:||:|||...|.:..|| .:.|:::.|..::|.
Human   181 NDYLRRQTYGQVVDCL-PE-FSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVP 243

  Fly   206 MMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILP---------TAIDGLPELEEKLGQLDMN 261
            ||.|....|:...:.|...:||:.: |.|...:::||         .|:.  |:...|.|||   
Human   244 MMHQKEMHRFLYDQDLACTVLQIEY-RGNALALLVLPDPGKMKQVEAALQ--PQTLRKWGQL--- 302

  Fly   262 EVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEM--KTPQKISEARH 324
                 .|...:|:.:|:|.|..|.:|:..|.::|:.::.:. :||.|.:...  ||..|:|   |
Human   303 -----LLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNL-EADFSGVTGQLNKTISKVS---H 358

  Fly   325 KVFLNVTEFGCEVAPEAEV--QPEVLK--KNPDRKFFKADRPFVFAIRD--RKNVYFVGHFVKP 382
            |..::::|.|.|....:.:  ||..|.  .:|...|   :|||:..:.:  .:::.|:|..|.|
Human   359 KAMVDMSEKGTEAGAASGLLSQPPSLNTMSDPHAHF---NRPFLLLLWEVTTQSLLFLGKVVNP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 99/384 (26%)
SERPINA11NP_001073920.1 alpha-1-antitrypsin_like 53..416 CDD:239011 99/384 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.