DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina3c

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:383 Identity:92/383 - (24%)
Similarity:178/383 - (46%) Gaps:37/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            |..:|::.|....|..|::.||....:|:.::.:||...:.:|:...|..   |.:|:.::....
  Rat    52 FTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKF---NLTEITEEEIHQ 113

  Fly    83 ----WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNK 143
                .....|..:....:...:.|::::|:.|.::|.:.....:.|||:..::....::.|.:|.
  Rat   114 GFGHLLQRLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNEAKKFIND 178

  Fly   144 WLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMR 208
            ::...|...:..||:.  .:..:|::|||.|.|:.||...|....|...:|:::.::.::|.||:
  Rat   179 YVSNQTQGKIAELFSD--LDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMK 241

  Fly   209 QIGQFR--YGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLMKE 271
             |....  |...::|...:|:|.: ..|.:.:.|||.        :.|:.|:: :.:..::|.|.
  Rat   242 -IKDLTTPYVRDEELSCSVLELKY-TGNASALFILPD--------QGKMQQVE-SSLQPETLKKW 295

  Fly   272 VD---------VTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVF 327
            .|         :.:|||.|....:|:..|.::||..:| :.|||||.:...|. ..:|:..||..
  Rat   296 KDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIF-SQQADLSRITGTKN-LHVSQVVHKAV 358

  Fly   328 LNVTEFGCEVAPEAEVQPEVLKKNPDR-KFFKADRPFVFAIRDR--KNVYFVGHFVKP 382
            |:|.|.|.|.|....| ...||..|.. .....:|||:..|.|.  ::|:|:|....|
  Rat   359 LDVDETGTEGAAATAV-TAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGKVTNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 91/378 (24%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 90/379 (24%)
RCL 365..392 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.