DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb6d

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:386 Identity:111/386 - (28%)
Similarity:194/386 - (50%) Gaps:27/386 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILG--VSN 71
            |.|:..   ||..|.:||:|:... |:.:||....|::.:..:||...:|.::|..|.|.  .|:
Mouse     5 PKLNTK---FAFKLLKALDDDTSK-NIFLSPPSIASSLAMTLLGAKENTARQIRQTLSLDKCSSD 65

  Fly    72 KSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYL-NPE 135
            ..|...|......:|.:....|:.|:...||:|.:...|:..|.|.:.:|:.||...|::. :.|
Mouse    66 PCEDIHQDFHLLLNEVNKTDPGIILKTENRLFVEKTFHIKKSFKDASQKFYKAEIEELDFKGDTE 130

  Fly   136 DSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQ 200
            .|.:.:|.|:.|:|...:::|.:|...||::.::|||..:|:..|.|.|.::.|:...|.::...
Mouse   131 QSRQHINTWVTKNTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKPFNKEDTREMPFRVSKNV 195

  Fly   201 RMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKL--------GQ 257
            ...|.||.|...|:....:::.::||.||:..:.|.|:|:||.....|..||:|:        ..
Mouse   196 VKPVQMMFQKSTFKITYIEEISTKILLLPYAGNKLNMIIMLPDEHVELRMLEKKMTYEKFVEWTS 260

  Fly   258 LD-MNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISE 321
            || |||       :||:|.:|:|::|...|:...|.|||:...|:.|:||.|.: ..|....:|:
Mouse   261 LDKMNE-------EEVEVFLPRFKLEEIYDMNNVLYKMGMTDAFEEGRADFSGI-SSKQGLFLSK 317

  Fly   322 ARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVGHFVKP 382
            ..:|.|:.|.|.|.:||...::  .::..:|....|.||.||:|. ...::...:|.|..|
Mouse   318 VIYKAFIEVIEKGTKVAAATDI--VMMGASPTTHTFCADHPFIFT-HMTEDFMIIGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 107/372 (29%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 110/384 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2787
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.