DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb8

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:375 Identity:100/375 - (26%)
Similarity:179/375 - (47%) Gaps:21/375 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            ||.:|.:.|:::....|:...|....||:.:|::||.|.:|.::..  :||:|...:| .|..::
Mouse    11 FAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSE--VLGLSGNGDV-HQSFQT 72

  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKK-VNKWLE 146
            ...|.:.......|:...||:..|.....:.|.:...:|:.|....|::....:..:| :|.|:.
Mouse    73 LLAEINKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKDTEGCRKHINDWVS 137

  Fly   147 KHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIG 211
            :.|...:..:.:|......:.::|||:::|:.||...|.::.|:...|..| :::..|.||.:..
Mouse   138 EKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTN-QEKKTVQMMFKHA 201

  Fly   212 QFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELE-----EKLGQLDMNEVAAKSLMKE 271
            :|:.|...::..|:|.||:....|:|:|:||.....|..:|     |||......|...:|   :
Mouse   202 KFKMGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTES---Q 263

  Fly   272 VDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCE 336
            |.|.:|:.::|.:.||:..||.:|:...|:..:||.|.:...|. ..:|:..||.|:.|.|.|.|
Mouse   264 VQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSGMTTKKN-VPVSKVAHKCFVEVNEEGTE 327

  Fly   337 VAPEAEV--QPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
            .|....|  .....:..|.   |.||.||:|.|...|  ::.|.|.|..|
Mouse   328 AAAATAVIRNARCCRTEPR---FCADHPFLFFIWHHKTSSILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 98/370 (26%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 99/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2787
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.