DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina3n

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:400 Identity:105/400 - (26%)
Similarity:180/400 - (45%) Gaps:43/400 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTTAPSLSASPI--VFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLIL 67
            ||...||:.:.|  .||.:|::.|..:.|..|::.||....:|:.::.:||.|.:.:|:...|..
Mouse    39 GTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKF 103

  Fly    68 GVSNKSEV-AKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNY 131
            .::..||. ..|.........:..|..|.:...:.|::.:.::|.|:|.:.|...:.|||::.::
Mouse   104 NLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADF 168

  Fly   132 LNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWI 196
            ..|..:.|.:|.::.|.|...::.|.:.  .:..:.::|||.::|:|||...|....|...:|:.
Mouse   169 QQPRQAKKLINDYVRKQTQGMIKELVSD--LDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYA 231

  Fly   197 NPRQRMEVSMMRQIG-QFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDM 260
            ..|:.:.|.||.... ...|...::|...:::|.: ..|.:.|.|||             .|..|
Mouse   232 GKRRPVIVPMMSMEDLTTPYFRDEELFCTVVELKY-TGNASAMFILP-------------DQGKM 282

  Fly   261 NEVAAKSLMKEV--------------DVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLF 311
            .:|.| ||..|.              ::.:|||.|.....|:..|.|:||..||.. |||||.:.
Mouse   283 QQVEA-SLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFST-QADLSAIT 345

  Fly   312 EMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQ--PEVLKKNPDRKFFKADRPFVFAIRDRKN-- 372
            ..| ..::|:..||..|:|.|.|.|.|....|:  |...|..|...:|  :|||:..|.|.:.  
Mouse   346 GTK-DLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYF--NRPFLIMIFDTETEI 407

  Fly   373 VYFVGHFVKP 382
            ..|:.....|
Mouse   408 APFIAKIANP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 99/380 (26%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 104/399 (26%)
RCL 367..392 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.