DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb9b

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:392 Identity:103/392 - (26%)
Similarity:190/392 - (48%) Gaps:36/392 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            :||.:...||.:|.:.|....|..|:..||....||:.:|.:||..::|.::...|.|   .|.:
Mouse     3 TLSEANGTFAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGL---KKEK 64

  Fly    75 VAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPE-DSV 138
            ...|.......:.:...:..:|.:..||:.::..::...|.:....|:::|...:|:.... :|.
Mouse    65 GIHQGFLKLLRKLNKPDRKYSLIVANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVESR 129

  Fly   139 KKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRME 203
            :.:|.|:.|.|...:..|...:..|..:.::|||:|:|:..|...|.::.|:...|:||..::..
Mouse   130 QCINTWVSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKRP 194

  Fly   204 VSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSL 268
            |.||.|...|.:....:|.:::|.:|:|...|::|::||.....|.::|        |::..:.|
Mouse   195 VQMMCQTDTFMFAFVDELPARLLIMPYEGMELSLMVLLPEKGVDLSKVE--------NDLTFEKL 251

  Fly   269 M----------KEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQK---IS 320
            :          .||.|.:|||:::...::|..||.:||..||:..:||||.:    :|::   :|
Mouse   252 IAWTKPDIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAM----SPERNLCLS 312

  Fly   321 EARHKVFLNVTEFGCEVAPEAEVQ---PEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFV 380
            :..||..:.|.|.|.|.|..:..:   |..|...|  .:|.||.||:|.||..:  ::.|.|.|.
Mouse   313 KFIHKSVVEVNEEGTEAAAASSAEGIIPLCLGGGP--SWFCADHPFLFFIRHNQTNSILFCGRFS 375

  Fly   381 KP 382
            .|
Mouse   376 SP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 99/379 (26%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 102/389 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2787
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.