DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINB1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_109591.1 Gene:SERPINB1 / 1992 HGNCID:3311 Length:379 Species:Homo sapiens


Alignment Length:396 Identity:116/396 - (29%)
Similarity:205/396 - (51%) Gaps:44/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEV 75
            ||::...||.:||.||::..|..|:.:||....|||.:||:|..|.:|.:| ||..    :.:.|
Human     4 LSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQL-SKTF----HFNTV 63

  Fly    76 AKQHAESWTDECSCAKKGVA--LRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-PEDS 137
            .:.|:...:......|:|.:  |:|..|||..:......:|.....:.:.|:..|:::.: .||:
Human    64 EEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDA 128

  Fly   138 VKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRM 202
            .|.:|:|::..|...:..|....:.::.:.::|||:::|:..|...|.::.|....|.:|.:.|.
Human   129 RKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRK 193

  Fly   203 EVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAID----GLPELEEKLGQLDMNEV 263
            .|.||.|..:|.||..:.||.::|:||::...|:|:|:||..|:    ||.::||:|....::|.
Human   194 TVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEW 258

  Fly   264 AAKSLMK--EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLS------DLFEMKTPQKIS 320
            .....:.  ||:|::|:|::|.:..|...|.::|:..:|::.:||||      |:|       ||
Human   259 TKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIF-------IS 316

  Fly   321 EARHKVFLNVTEFGCE-------VAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFV 376
            :..||.|:.|.|.|.|       :|....:.||        :.|.||.||:|.||...  ::.|:
Human   317 KIVHKSFVEVNEEGTEAAAATAGIATFCMLMPE--------ENFTADHPFLFFIRHNSSGSILFL 373

  Fly   377 GHFVKP 382
            |.|..|
Human   374 GRFSSP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 112/384 (29%)
SERPINB1NP_109591.1 SERPIN 4..379 CDD:294093 115/394 (29%)
CARD-binding motif (CBM). /evidence=ECO:0000269|PubMed:30692621 351..379 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.