DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinf2

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:387 Identity:90/387 - (23%)
Similarity:170/387 - (43%) Gaps:47/387 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEV 75
            |:.:.:.|..:||..:.......|:::||.....|::.:.:||..::...|...|.:...     
Mouse    82 LAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTG----- 141

  Fly    76 AKQHAESWTDECSCAKKGVA----------LRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLN 130
                        ||....::          :||..|:|:.:...|:.||.:.:...|.|:...|.
Mouse   142 ------------SCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLT 194

  Fly   131 YLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSV-ILVNSLFFRAKWNKIFPQQLTQIDDF 194
            ....|| :..:|:|:::.|...:.: |..|:  .||:| :|:|::.|...|...|...|||.|.|
Mouse   195 GKQEED-LANINQWVKEATEGKIED-FLSEL--PDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFF 255

  Fly   195 WINPRQRMEVSMMRQIG-QFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQL 258
            .::.|..:.|.||..:. ..|:...::.:.|:...|| ::|::.::::||..:.  .:.|.|..|
Mouse   256 HLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPF-KNNMSFVVVMPTYFEW--NVSEVLANL 317

  Fly   259 DMNEVAAKSLM-KEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEA 322
            ..:.:...||. :...|.:||..::..:||...|.::|:..:|..  .||..:.|...  .:|..
Mouse   318 TWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQG--PDLRGISEQNL--VVSSV 378

  Fly   323 RHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI-RDRKNV-YFVGHFVKP 382
            :|:..:.::|.|.|.|....|....:..:.    |..:|||:|.| .|...| .|||....|
Mouse   379 QHQSTMELSEAGVEAAAATSVAMNRMSLSS----FTVNRPFLFFIMEDTIGVPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 88/375 (23%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 89/382 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.