DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina10

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_598301.2 Gene:Serpina10 / 171154 RGDID:621220 Length:436 Species:Rattus norvegicus


Alignment Length:364 Identity:90/364 - (24%)
Similarity:178/364 - (48%) Gaps:34/364 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKS------EVAKQHAESWTDECSCAKK 92
            |::.||.|...||..:.:||.|::..::.:.|.|...:::      .:.|:..|:::     :.|
  Rat    89 NVIFSPFGLSVAMVNLMLGAKGETKVQVENGLNLQALSQAGPLILPALFKRVKETFS-----SNK 148

  Fly    93 GVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEKHTFYTVRNLF 157
            .:.|...:..:::::.:|:..:.:::..:|:.|....|:.|...:...:|.::.|.|...:..||
  Rat   149 KLGLTQGSFAFIHKDFEIKKTYFNLSTMYFDTEYVPTNFRNSSQARGLMNHYINKETEGKIPKLF 213

  Fly   158 TPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQFRYGESKKLK 222
              :..|.::.:|||:.:.|:.||...|....|:.|.|.::..:.::|.||.:.|.|.....||.:
  Rat   214 --DEINPETKLILVDYILFKGKWLTPFDPIFTEADTFHLDKYKAVKVPMMYREGNFASTFDKKFR 276

  Fly   223 SQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSL-MKEVDVTIPKFRIECTVD 286
            ..||:||:: .|.||:::|.........||:.| ..|:.|:..:.: .::::|..|||::....:
  Rat   277 CHILKLPYQ-GNATMLVVLMEKSGDHLALEDYL-TTDLVEMWLQDMKTRKMEVFFPKFKLNQRYE 339

  Fly   287 LKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAP------EAEVQP 345
            :...|:::||..:|.. .||||:|..:....::|:...:..|.|.|.|.||..      .|...|
  Rat   340 MHELLKQVGIRRIFST-SADLSELSAVARNLQVSKVVQQSVLEVDERGTEVVSGTVSEITAYCMP 403

  Fly   346 EVLKKNPDRKFFKADRPFVFAIRDRKN--VYFVGHFVKP 382
            .|:         |.||||.|.|.:..:  :.|:|..|.|
  Rat   404 PVI---------KVDRPFHFIIYEEMSQMLLFLGRVVNP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 88/359 (25%)
Serpina10NP_598301.2 SERPIN 66..430 CDD:294093 88/359 (25%)
Heparin-binding. /evidence=ECO:0000250 128..145 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.