DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA12

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:366 Identity:100/366 - (27%)
Similarity:184/366 - (50%) Gaps:36/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAESW---TDECSCAKK 92
            |..|:.:||....:|.:::.:||...:.||::.    |.:.:....|...|.:   ..|.:...:
Human    68 PGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQ----GFNFRKMPEKDLHEGFHYIIHELTQKTQ 128

  Fly    93 GVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEKHTFYTVRNLF 157
            .:.|.:...|::::..:.:..|.:.|..|::||....|:.|.|.:.|::|.::.:.|...:.||.
Human   129 DLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLI 193

  Fly   158 TPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQFRYGESKKLK 222
              |..:..:.::|.|.:||||:|...|...:|:.:||::.....::|.||.:.|.::.|...||.
Human   194 --ENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLS 256

  Fly   223 SQILQLPFERSNLTMMIILPTAIDG-LPELEEKLGQLDMNEVAAKSLM--KEVDVTIPKFRIECT 284
            ..||::|::: |:|.:.|||.  :| |..||:.| |:|... ..|:|:  :.|||::|:..:..|
Human   257 CTILEIPYQK-NITAIFILPD--EGKLKHLEKGL-QVDTFS-RWKTLLSRRVVDVSVPRLHMTGT 316

  Fly   285 VDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQ----- 344
            .|||..|..:|::.:|:. ..||:.:...:: .|:.||.||..|.:.|.|.|.|.....|     
Human   317 FDLKKTLSYIGVSKIFEE-HGDLTKIAPHRS-LKVGEAVHKAELKMDERGTEGAAGTGAQTLPME 379

  Fly   345 -PEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
             |.|:         |.|:|::..|...|  :|.|:|..|.|
Human   380 TPLVV---------KIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 98/361 (27%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 99/364 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.