DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinh1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:393 Identity:97/393 - (24%)
Similarity:186/393 - (47%) Gaps:22/393 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGGTTAPSLSASPIVFAR-------NLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSAD 59
            |:...||..||:.....|.       :|::|:..:....|:::||....|::.||.:  |||:..
Mouse    26 AAAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVENILLSPLVVASSLGLVSL--GGKATT 88

  Fly    60 ELRSKLILGVS--NKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFF 122
            ..::|.:|...  ...||.....|......:...:.|..:|.:|||.........||...:.:.:
Mouse    89 ASQAKAVLSAEKLRDEEVHTGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHY 153

  Fly   123 NAEAYSLNYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQ 187
            |.|...:|:.:...:::.:|:|..:.|...:..: |.:|..:|.: :|||::||:..|::.|..:
Mouse   154 NCEHSKINFRDKRSALQSINEWASQTTDGKLPEV-TKDVERTDGA-LLVNAMFFKPHWDEKFHHK 216

  Fly   188 LTQIDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELE 252
            :.....|.:.....:.|:||.:.|.:.|.:.:|.|.|::::|......:::|::|..::.|..||
Mouse   217 MVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLE 281

  Fly   253 EKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQ 317
            :.|.:..:.....|...|.|.:::||..:|.|.||:..|..:|:....|..:||||.:...|...
Mouse   282 KLLTKEQLKAWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLY 346

  Fly   318 KISEARHKVFLNVTEFGCEVAP-EAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHF 379
            ..|......|    |:..|..| :.::......::|  |.|.||.||:|.:||.:  ::.|:|..
Mouse   347 LASVFHATAF----EWDTEGNPFDQDIYGREELRSP--KLFYADHPFIFLVRDNQSGSLLFIGRL 405

  Fly   380 VKP 382
            |:|
Mouse   406 VRP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 90/372 (24%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 94/384 (24%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.