DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina6

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:381 Identity:94/381 - (24%)
Similarity:167/381 - (43%) Gaps:53/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFR---ALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNK 72
            |:.:.:.||.||::   |||.:   .|.::||.....|:.::.:...|.:  :....|...:|..
Mouse    34 LAPTNVDFAFNLYKRLVALNSD---KNTLISPVSISMALAMLSLSTRGST--QYLENLGFNMSKM 93

  Fly    73 SEV----AKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN 133
            ||.    ..|:..|...:   :..|:.:.:...:::.:..|::..|......::.:||.::    
Mouse    94 SEAEIHQGFQYLNSLLQQ---SDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTI---- 151

  Fly   134 PEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSS--VILVNSLFFRAKWNKIFPQQLTQIDDFWI 196
            |.....|..:.:..|.....:......|.:.|||  :||:|.:|.:..|...|..:.|:.:||::
Mouse   152 PSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYV 216

  Fly   197 NPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMN 261
            |....::|.||.|.|...|.....:..|::|:.:. .|.|..||||..           ||:| .
Mouse   217 NETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYV-GNGTTFIILPDQ-----------GQMD-T 268

  Fly   262 EVAAKS-----------LMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKT 315
            .|||.:           :.:::::.||||.:..|.||:..|..:||..:| ..|:|.:|..: .|
Mouse   269 VVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLF-TNQSDFADTTK-DT 331

  Fly   316 PQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKF-FKADRPFVFAIRDR 370
            |..:: ..||..|.:.|  ..|.|.|...|.|  ..|...| .|.:|||:|...|:
Mouse   332 PLTLT-VLHKAMLQLDE--GNVLPAATNGPPV--HLPSESFTLKYNRPFIFLAFDK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 93/374 (25%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 91/372 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.