DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serping1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:407 Identity:91/407 - (22%)
Similarity:181/407 - (44%) Gaps:86/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFRALN-DEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            ||.:...|:..|:.|.: .::...||..||....|.:|.|.:|||..:...|.|.|         
Mouse   147 LSEALTDFSVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGAGDSTKSNLESIL--------- 202

  Fly    75 VAKQHAESWTDECSC---AKKGVALRLVT---RLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN 133
                   |:..:.:|   |.||.:.:.||   :::.:.:..||..:.:.:...:.:   |...|.
Mouse   203 -------SYPKDFACVHQALKGFSSKGVTSVSQIFHSPDLAIRDTYVNASQSLYGS---SPRVLG 257

  Fly   134 PED--SVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWI 196
            |:.  :::.:|.|:.::|.:.:|.|.  :...||:.::|:|:::..|||...|..:......|:.
Mouse   258 PDSAANLELINTWVAENTNHKIRKLL--DSLPSDTCLVLLNAVYLSAKWKITFEPKKMMAPFFYK 320

  Fly   197 NPRQRMEVSMMRQ----IGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQ 257
            |  ..::|.||..    :.||   :...||:::.||.... ||:.:|::|.    .|:.:.|..:
Mouse   321 N--SMIKVPMMSSVKYPVAQF---DDHTLKAKVGQLQLSH-NLSFVIVVPV----FPKHQLKDVE 375

  Fly   258 LDMNEVAAKSLMKEVD--------VTIPKFRIECTVDLKVPLQKMGINSVFD-------AGQADL 307
            ..:|....|::||:::        :|:|..:::.:.|:...::|:   ..||       .|..:.
Mouse   376 KALNPTVFKAIMKKLELSKFLPTYLTMPHIKVKSSQDMLSVMEKL---EFFDFTYDLNLCGLTED 437

  Fly   308 SDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQ-----PEVLKKNPDRKFFKADRPFVFAI 367
            .||       ::|..:|:..|.:||.|.|.|..:.:.     |          .|:..|||:|.:
Mouse   438 PDL-------QVSAMKHETVLELTESGVEAAAASAISFGRSLP----------IFEVQRPFLFLL 485

  Fly   368 RDRKNVY--FVGHFVKP 382
            .|:::.:  |:|....|
Mouse   486 WDQQHRFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 88/395 (22%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141
serpinG1_C1-INH 141..500 CDD:381006 90/403 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.