DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb5

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_476449.2 Gene:Serpinb5 / 116589 RGDID:69342 Length:375 Species:Rattus norvegicus


Alignment Length:374 Identity:101/374 - (27%)
Similarity:193/374 - (51%) Gaps:18/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            ||..||:.|.::.|..|::.||....::::|..:||.|.:|:|:..  :|...|..:|.... ::
  Rat    11 FAVELFKQLCEKEPAGNILFSPICLSTSLSLAQVGAKGDTANEIGQ--VLHFENVKDVPFGF-QT 72

  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNP-EDSVKKVNKWLE 146
            .|.:.:......:|:|:.|||:::...:.|:|.......:..|..::::.:. |::..::|..::
  Rat    73 ITSDVNKLSSFYSLKLIKRLYIDKSLNLSTEFISSTKRPYANELETVDFKDKLEETKGQINSSIK 137

  Fly   147 KHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIG 211
            :.|.....::......:..:.:::||:.:|..||.|.||:..|:...|.||......|.||....
  Rat   138 ELTDGHFEDILPENSISDQTKILVVNAAYFVGKWMKKFPESETKECPFRINKTDTKPVQMMNLEA 202

  Fly   212 QFRYGESKKLKSQILQLPFERSNLTMMIILPTAID----GLPELEEKLGQLDMNEVAAKSLM--K 270
            .|..|....:..:|::|||:..:|:|:|:||..::    ||.::|::|....:.:....|.|  .
  Rat   203 TFCLGNIDDINCKIIELPFQNKHLSMLIVLPKDVEDESTGLEKIEKQLNPETLLQWTNPSTMANA 267

  Fly   271 EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGC 335
            :|.:::|||::|..:|.|..|:.:|:.|:|:...:|.|.:.|.| ...:|...|:|.|.:||.| 
  Rat   268 KVKLSLPKFKVEKMIDPKASLESLGLKSLFNESTSDFSGMSETK-GVSVSNVIHRVCLEITEDG- 330

  Fly   336 EVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
              ....||....:.::.|.  ||||.||:|.:|..|  |:.|:|.|..|
  Rat   331 --GDSIEVPGSRILQHKDE--FKADHPFLFIVRHNKTRNIVFLGKFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 99/369 (27%)
Serpinb5NP_476449.2 serpinB5_maspin 1..375 CDD:381013 100/372 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.