DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47a and Obp99b

DIOPT Version :9

Sequence 1:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:144 Identity:29/144 - (20%)
Similarity:57/144 - (39%) Gaps:23/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLVLLLVLKMFALSESRFAKININLGLTVADESPKTITEEMIRL---CGDQTDISLRELNKLQR 64
            :||::||:...|.|::.....         .|...|| .|::...   |.::...|...:.|.::
  Fly     2 KVLIVLLLGLAFVLADHHHHH---------HDYVVKT-HEDLTNYRTQCVEKVHASEELVEKYKK 56

  Fly    65 EDFSDPSESVQCFTHCLYEQMGL--MHDGVFVER---DLFGLLSDVSNTDYWPERQCHAIRGNNK 124
            ..:.|.:.: .|:..|::::.|.  ...|..|.:   .|.|...:|..:|...::..|....::|
  Fly    57 WQYPDDAVT-HCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAHCAETHSK 120

  Fly   125 ----CETAYRIHQC 134
                |..||....|
  Fly   121 EGDSCSKAYHAGMC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 18/92 (20%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.