DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47a and Obp83ef

DIOPT Version :9

Sequence 1:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:140 Identity:34/140 - (24%)
Similarity:54/140 - (38%) Gaps:36/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SPKTITEEMIRLC--------GDQTDIS--LRELN----------KLQREDFSDPSESVQCFTHC 80
            ||:.:...:..:|        ||...:.  ||:|:          ||:|.. |...|.|.|...|
  Fly     3 SPRAVLVSLFLICSQALADLSGDAQTLEKCLRQLSSPESIAGDLRKLERYS-SWTREEVPCLMRC 66

  Fly    81 LYEQMGLMHDGVFVERDLFGLL-------SDVSNTDYWPERQCHAIRGNNKCETAYRIHQCQQQL 138
            |..:.|...    ||.:.:.|.       :||.|...:..|:    .|::.|..|||..:|.:|.
  Fly    67 LAREKGWFD----VEENKWRLKQLTEDLGADVYNYCRFELRR----MGSDGCSFAYRGLRCLKQA 123

  Fly   139 KQQQQNLLAT 148
            :......|:|
  Fly   124 EMHAGTSLST 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 28/110 (25%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 27/104 (26%)
PhBP 133..234 CDD:214783 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.