DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47a and Obp56b

DIOPT Version :9

Sequence 1:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:66/141 - (46%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLVLLLVLKMFALSESRFAKININLGLTVADESPKTIT--EEMIRLCGDQTDISLRELNKLQRE 65
            :::.||:|..:|||||            .||.:|...:.  :::.:.|..:.:|:..:.|.|..:
  Fly     2 KLIYLLVVFLIFALSE------------LVAGQSAAELAAYKQIQQACIKELNIAASDANLLTTD 54

  Fly    66 -DFSDPSESVQCFTHCLYEQMGLMHDGVFVERDLFGLLSDVSNTDYWPER------QCHAIRGNN 123
             :.::|||||:|:..|:|:::||:.|......|....|:.:..:....::      .|...:...
  Fly    55 KEVANPSESVKCYHSCVYKKLGLLGDDGKPNTDKIVKLAQIRFSSLPVDKLKSLLTSCGTTKSAA 119

  Fly   124 KCETAYRIHQC 134
            .|:..|...:|
  Fly   120 TCDFVYNYEKC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 20/90 (22%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.