DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47a and Obp56a

DIOPT Version :9

Sequence 1:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster


Alignment Length:142 Identity:38/142 - (26%)
Similarity:72/142 - (50%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRVLVLLLVLKMFALSESRFAKININLGLTVADESPKTITEEMIRLCGDQTDISLRELNKLQRE 65
            ||...|:.|        .:.|..:.:...|.::||. |.:.::....|.::..::..|..|:..:
  Fly     1 MNSYFVIAL--------SALFVTLAVGSSLNLSDEQ-KDLAKQHREQCAEEVKLTEEEKAKVNAK 56

  Fly    66 DFSDPSESVQCFTHCLYEQMGLMHDGVFVER---DLFGLLSDVSNTDYWPERQCHAIRGNNKCET 127
            ||::|:|:::||.:|.:|::|.:.||...|.   :..|.|.....|....|: |..|:|.|||:|
  Fly    57 DFNNPTENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTKAALEK-CRTIKGENKCDT 120

  Fly   128 AYRIHQCQQQLK 139
            |.:::.|.:..|
  Fly   121 ASKLYDCFESFK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 27/86 (31%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.