DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47a and Obp19c

DIOPT Version :9

Sequence 1:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster


Alignment Length:146 Identity:33/146 - (22%)
Similarity:57/146 - (39%) Gaps:47/146 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PKTITE-------------------------EMIRLCGDQTDISLRELNKLQREDFSDPSESVQC 76
            |||.||                         :.::|..||     |.|.|:     ::|||..:|
  Fly    40 PKTGTEPIWAVIDRNLPQVQELVTAARMECIQKLQLPRDQ-----RPLGKV-----TNPSEKEKC 94

  Fly    77 FTHCLYEQMGLMH-DGVF----VERDLFGLLSD-----VSNTDYWPERQCHAIRGNNKCETAYRI 131
            ...|:.:::.||. |...    ||: |..|::.     ::.:....:.....|...|.||.|:..
  Fly    95 LVECVLKKIKLMDADNKLNVGQVEK-LTSLVTQDNKMAIAVSSSMAQACSRGISSKNPCEVAHLF 158

  Fly   132 HQC-QQQLKQQQQNLL 146
            :|| .:||::....|:
  Fly   159 NQCISRQLERNNVKLV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 22/93 (24%)
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.