DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp47a and Obp51a

DIOPT Version :9

Sequence 1:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_725436.1 Gene:Obp51a / 246666 FlyBaseID:FBgn0043530 Length:117 Species:Drosophila melanogaster


Alignment Length:141 Identity:39/141 - (27%)
Similarity:57/141 - (40%) Gaps:37/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLLVLKMF--ALSESRFAKININLGLTVADESPKTITEEMIRLCGDQTDISLRELNKLQREDF 67
            |||||.:...  ||.||...:....||:|     |...                        |:|
  Fly     7 LVLLLAVTTLSSALFESEANECAKKLGIT-----PDYF------------------------ENF 42

  Fly    68 SDPSESVQCFTHCLYEQMGLMHDGVFVERDLFGL-LSDVSNTDYWPE-RQCHAIRGNNKCETAYR 130
            .. |..|:||.||..|::.::.:||....||..| :|..|...|..: :.|..:...:|||..|.
  Fly    43 PH-SSRVKCFYHCQMEKLEIIANGVVTPFDLKVLNISPESYDKYGVKVKPCLKLSHRDKCELGYL 106

  Fly   131 IHQCQQQLKQQ 141
            :.||   ||::
  Fly   107 VFQC---LKRE 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 22/85 (26%)
Obp51aNP_725436.1 PBP_GOBP 25..114 CDD:279703 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006711
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.