DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polyph and Slc38a11

DIOPT Version :9

Sequence 1:NP_610631.1 Gene:polyph / 36161 FlyBaseID:FBgn0033572 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001363948.1 Gene:Slc38a11 / 362141 RGDID:1306005 Length:464 Species:Rattus norvegicus


Alignment Length:430 Identity:85/430 - (19%)
Similarity:163/430 - (37%) Gaps:79/430 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQDQAPNRDDPDLQTEPLTIAQSITSFYMYNPYEKRSVEVPLTNCDAFISLLKCVIGTGILAMPL 69
            |..|...|.....:|:| :..:|:.|.:.:.....:|.        |..:::..|||:||:.:|.
  Rat     2 SYQQPQLRGPLQRETDP-SDRESLVSGHEHGGKSSQSA--------AVFNVVNSVIGSGIIGLPY 57

  Fly    70 AFRCSGFVMGTVMSILLMILLTYSIHLLIADMTECCRRRRVPQVSMPEAVRIAYEEGPKWINCFG 134
            :.:.:||.:|.::...:..:..:|:.|||...                    |......:.:...
  Rat    58 SMKQAGFPLGILLLFWVSYITDFSLVLLIKGG--------------------ALSGTDSYQSLVN 102

  Fly   135 RAAGFMTTCVLVFGQFLLCTVYLVF---------------VSKNFKEI-----GDHYIERYNERY 179
            :..||.       |..||.|:..::               :||.|:.:     |..:|.|:   :
  Rat   103 KTFGFP-------GYLLLSTLQFMYPFIAMISYNIITGDTLSKVFQRLPGVDPGSWFISRH---F 157

  Fly   180 YVLVACL-LLLPLFMIRRLKYLVPLNLISNFLLYAGFALIMYYLFNGLPNI--NDREMVTPPVEW 241
            .::|:.: ..|||.:.|.:..|..::.||..|......:::....:..|||  .|...|......
  Rat   158 IIVVSTVTCTLPLSLYRDIAKLGKISFISTILTAVILGVVVTRTISLGPNIPKTDNAWVFARPNA 222

  Fly   242 IEFIAIAAFSLTAVGSMLVVEAHMAHPQSYLGLFGVLNLAVLFILLSNMFFGIIGYWRFGDNVHA 306
            |:.|.:.:|:.....:..:|...:..| :......|::.::|..:...:.|...||:.|......
  Rat   223 IQAIGVMSFAFICHHNCFLVYGSLEEP-TVAKWRRVIHTSILVSVFICVLFATCGYFTFTGFTQG 286

  Fly   307 SITLNIPQDEILSQFIKVFIASGIFLSYPLNGFV---VIT-VMFSDYENSEPRGRYRTLIEYVVR 367
            .:..|..:.:.|..|.:......:.|:||:..||   ||| |.|....:|          .:.|.
  Rat   287 DLFENYCRSDDLVTFGRFCYGITVILTYPIECFVTREVITNVFFGGALSS----------VFHVT 341

  Fly   368 LLFLFLTGAVAIG--VPNLAALTELEGAFSLSNLNLLCPA 405
            |....:|.|..|.  :..|..:.||.|....:.|..:.|:
  Rat   342 LTAAIVTAATLISLLIDCLGIVLELNGVLCAAPLIFIIPS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyphNP_610631.1 SLC5-6-like_sbd 50..407 CDD:320982 77/385 (20%)
Slc38a11NP_001363948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 7/32 (22%)
SLC5-6-like_sbd 32..420 CDD:382020 78/399 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.