DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polyph and SLC32A1

DIOPT Version :9

Sequence 1:NP_610631.1 Gene:polyph / 36161 FlyBaseID:FBgn0033572 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_542119.1 Gene:SLC32A1 / 140679 HGNCID:11018 Length:525 Species:Homo sapiens


Alignment Length:441 Identity:97/441 - (21%)
Similarity:180/441 - (40%) Gaps:68/441 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LTNCDAFISLLKCVIGTGILAMPLAFRCSGFVMGTVMSILLMILLTYSIHLLIADMTECCRRRRV 110
            :|..:|..::...:.|..:|.:|.|....|: :|..:.|...::..|:..:|||.:.|       
Human   116 ITAWEAGWNVTNAIQGMFVLGLPYAILHGGY-LGLFLIIFAAVVCCYTGKILIACLYE------- 172

  Fly   111 PQVSMPEAVRI--AYEE------GPKWINCFGRAAGFMTTCVLVFGQFLLCTVYLVFVSKNFKEI 167
             :....|.||:  :|..      .|::....||.........||    :.|.:|:| ||.|.   
Human   173 -ENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELV----MTCILYVV-VSGNL--- 228

  Fly   168 GDHYIERYN--------ERYYVLVACLLLLPLFMIRRLKYLVPLNLISNFLLYAGFALIMYYLFN 224
                  .||        ::.:.::|..:|||...::.||.:...:|:.....:....|::.|.  
Human   229 ------MYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYC-- 285

  Fly   225 GLPNIND--REMVTPPVEWIEF---IAIAAFSLTAVGSMLVVEAHMAHPQSYLGLFGVLNLAVLF 284
             |....|  .|.|...::..:|   |.|..||.|:...:..:|.:|..|..:..:....::|...
Human   286 -LSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACV 349

  Fly   285 ILLSNMFFGIIGYWRFGDNVHASITLNIPQDEILSQFIKVFIASGIFLSYPLNGFVVITVMFSDY 349
            :   ...|.::.|..:.|.....||.|:|..  :...:.:|:.:...|||||..|..:.|:....
Human   350 L---KGLFALVAYLTWADETKEVITDNLPGS--IRAVVNIFLVAKALLSYPLPFFAAVEVLEKSL 409

  Fly   350 ENSEPR----------GRYRTLIEYVVRLLFLFLTGAVAIGVPNLAALTELEGAFSLSNLNLLCP 404
            .....|          ||.::. ...:|...:..|..:||.||:.|.|..|.|:.:.:.|..|.|
Human   410 FQEGSRAFFPACYSGDGRLKSW-GLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLP 473

  Fly   405 ALIDVFLNYNVGYGRLMW-KLIRDILLILIGLIFGIVGCTVALMQLIRDFQ 454
            :|..:.|.:.    :|:| ::..|:.:.:||.|..:.|...:|..||..::
Human   474 SLFHLRLLWR----KLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyphNP_610631.1 SLC5-6-like_sbd 50..407 CDD:320982 84/387 (22%)
SLC32A1NP_542119.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..107
Aa_trans 115..512 CDD:279788 94/431 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.