DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polyph and slc38a3a

DIOPT Version :10

Sequence 1:NP_610631.1 Gene:polyph / 36161 FlyBaseID:FBgn0033572 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001092235.1 Gene:slc38a3a / 100073328 ZFINID:ZDB-GENE-070615-25 Length:189 Species:Danio rerio


Alignment Length:95 Identity:25/95 - (26%)
Similarity:42/95 - (44%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSQDQAPNRDDPDLQTEPLTIAQSITSFYMYNPYEKRSVEVPLTNCDAFISLLKCVIGTGILAMP 68
            :|.:...|.||.  :|...|..:..|||.|                 :..:|...::|:|||.:.
Zfish    49 ESSEFLSNADDK--KTPRFTDFEGKTSFGM-----------------SVFNLGNAIMGSGILGLA 94

  Fly    69 LAFRCSGFVMGTVMSILLMILLTYSIHLLI 98
            .|...:|.|:..::..::..|..||||||:
Zfish    95 YAMANTGIVLFVILLTVVAGLSAYSIHLLL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyphNP_610631.1 SLC5-6-like_sbd 50..407 CDD:444915 15/49 (31%)
slc38a3aNP_001092235.1 SLC5-6-like_sbd 70..>182 CDD:444915 19/72 (26%)

Return to query results.
Submit another query.