DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and RPB5C

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_200606.1 Gene:RPB5C / 835909 AraportID:AT5G57980 Length:210 Species:Arabidopsis thaliana


Alignment Length:208 Identity:78/208 - (37%)
Similarity:132/208 - (63%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHN 65
            ||||..  :::::|:|::|:..||||.:.:.:|:...|:|.:.|  ..:..:..:..|.|.....
plant     4 MDDEIT--RIFKVRRTVLQMLRDRGYTIEESDLNLKREEFVQRF--CKTMNKVNKEALFVSANKG 64

  Fly    66 DDPTDQMFVFFPEEPKIGIKTI-KTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQ 129
            .:|.|:::||:||.||:|:..| |....:|:::.:||.||||...:|..|:.::.::.....:|.
plant    65 PNPADKIYVFYPEGPKVGVPVIKKEVAIKMRDDKVHRGIVVVPMAITAPARMAVSELNKMLTIEV 129

  Fly   130 FLESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKII 194
            |.|:||:.|||||:||.::.|:..:.|::||:.|.:::..|.||...||:|||:||||||||||.
plant   130 FEEAELVTNITEHKLVNKYYVLDDQAKKKLLNTYTVQDTQLPRILVTDPLARYYGLKRGQVVKIR 194

  Fly   195 RSSETAGRYISYR 207
            ||..|:..|.:||
plant   195 RSDATSLDYYTYR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 78/208 (38%)
RPB5CNP_200606.1 PLN03111 1..210 CDD:215582 78/208 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54766
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10535
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.