DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and RPB5E

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_191013.1 Gene:RPB5E / 824614 AraportID:AT3G54490 Length:233 Species:Arabidopsis thaliana


Alignment Length:205 Identity:66/205 - (32%)
Similarity:113/205 - (55%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHNDDPTD 70
            |:.:.:..|.|..::..||||.|.:.||..||.:|:.:||:||..:|     |.:.|....||..
plant    35 ESKRFYLARTTAFEMLRDRGYEVNEAELSLTLSEFRSVFGEKPELER-----LRICVPLRSDPKK 94

  Fly    71 QMFVFFPEEPKIGIKTIKTYCTRMQEE-NIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQFLESE 134
            ::.|.|.....|.:|:::....::... .:|..|:|:|..|...|:::|...  .:.:|.|...:
plant    95 KILVVFMGTEPITVKSVRALHIQISNNVGLHAMILVLQSKMNHFAQKALTTF--PFTVETFPIED 157

  Fly   135 LLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIRSSET 199
            ||:|||:|...|:..::..|||::||.::.|::..|..:|..|...||:|||:.|||||..|.|.
plant   158 LLVNITKHIQQPKIEILNKEEKEQLLRKHALEDKQLPYLQEKDSFVRYYGLKKKQVVKITYSKEP 222

  Fly   200 AGRYISYRLV 209
            .|.:::||.:
plant   223 VGDFVTYRCI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 66/205 (32%)
RPB5ENP_191013.1 PLN03111 29..233 CDD:215582 66/205 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10535
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.