DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and AT3G16680

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_188290.1 Gene:AT3G16680 / 820920 AraportID:AT3G16680 Length:87 Species:Arabidopsis thaliana


Alignment Length:79 Identity:32/79 - (40%)
Similarity:50/79 - (63%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 IKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMA---PKYILEQFLESELLINITEHELVPEH 148
            :|.|..:::..|:.|||:||| .:...::|:||.:.   |.:.:|.|.|.||::|:.||..||||
plant     1 MKKYIDQLKSANVFRAILVVQ-DIKAFSRQALVFLGAVYPIFHIEVFQEKELIVNVKEHVFVPEH 64

  Fly   149 VVMTVEEKQELLSR 162
            ..:|.||||:.|.|
plant    65 QALTTEEKQKFLER 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 32/79 (41%)
AT3G16680NP_188290.1 RNA_pol_Rpb5_N <1..>78 CDD:392201 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 1 1.000 - - FOG0003717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10535
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.