DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and RPB5D

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_181665.1 Gene:RPB5D / 818732 AraportID:AT2G41340 Length:218 Species:Arabidopsis thaliana


Alignment Length:211 Identity:65/211 - (30%)
Similarity:121/211 - (57%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVA-HNDDPT 69
            |.:|.:..|:|.|::..||||.|:.::::.:|:||:.::|:.|.      .||:.:.| |..|.:
plant    20 ECHKYYLARRTTMEMLRDRGYDVSDEDINLSLQQFRALYGEHPD------VDLLRISAKHRFDSS 78

  Fly    70 DQMFVFFPEEPKIGIKTIKTYCTR------MQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILE 128
            .::.|.|     .|...:|....|      :..|||...|:|:|..:|..|.:::...:.|  :|
plant    79 KKISVVF-----CGTGIVKVNAMRVIAADVLSRENITGLILVLQSHITNQALKAVELFSFK--VE 136

  Fly   129 QFLESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKI 193
            .|..::||:|:::|.|.|:|.|:..:||:.||.::.::|..|.|:.:.||:.||:||:.|||:|:
plant   137 LFEITDLLVNVSKHVLRPKHQVLNDKEKESLLKKFSIEEKQLPRLSSKDPIVRYYGLETGQVMKV 201

  Fly   194 IRSSETAGRYISYRLV 209
            ....|.:..:::||.|
plant   202 TYKDELSESHVTYRCV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 65/211 (31%)
RPB5DNP_181665.1 PLN03111 14..217 CDD:215582 64/209 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54766
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10535
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.