DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and Polr2e

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_006241071.1 Gene:Polr2e / 690966 RGDID:1589817 Length:242 Species:Rattus norvegicus


Alignment Length:190 Identity:160/190 - (84%)
Similarity:173/190 - (91%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHN 65
            ||||.|||:||:||||||||.|||||||||||||||||:||..|||||||.||.|:||.||||||
  Rat     1 MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHN 65

  Fly    66 DDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQF 130
            ||||||||||||||||:||||||.||.|||||||.||::|||.|||||||||||||||||:||||
  Rat    66 DDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYVLEQF 130

  Fly   131 LESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQV 190
            |:.|||||||||||||||||||.||..|||:||||:|:.|.|||||||||||||:|||||
  Rat   131 LQQELLINITEHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 160/190 (84%)
Polr2eXP_006241071.1 PLN03111 1..190 CDD:215582 158/188 (84%)
RNA_pol_Rpb5_N 4..92 CDD:281816 74/87 (85%)
RNA_pol_Rpb5_C 138..>190 CDD:279524 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346780
Domainoid 1 1.000 165 1.000 Domainoid score I3840
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2018
Inparanoid 1 1.050 360 1.000 Inparanoid score I2137
OMA 1 1.010 - - QHG54766
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 1 1.000 - - FOG0003717
OrthoInspector 1 1.000 - - oto97616
orthoMCL 1 0.900 - - OOG6_101049
Panther 1 1.100 - - LDO PTHR10535
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3076
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.