DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and polr2e

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001016473.1 Gene:polr2e / 549227 XenbaseID:XB-GENE-1005304 Length:210 Species:Xenopus tropicalis


Alignment Length:209 Identity:177/209 - (84%)
Similarity:191/209 - (91%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHN 65
            ||||.|||:||:||||||||.||||||||||||||||::||..|||||||.||.|:||.||||||
 Frog     1 MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLDEFKAQFGDKPSEGRPRRTDLTVLVAHN 65

  Fly    66 DDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQF 130
            ||||||||||||||||:||||||.||.|||||||.||::|||.||||||||||||||||||||||
 Frog    66 DDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQF 130

  Fly   131 LESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIR 195
            |:.|||||||||||||||||||.:|..|||:||||:|:.|.||||||||||||||||||||||||
 Frog   131 LQQELLINITEHELVPEHVVMTKDEVTELLARYKLRESQLPRIQAGDPVARYFGLKRGQVVKIIR 195

  Fly   196 SSETAGRYISYRLV 209
            .||||||||:||||
 Frog   196 PSETAGRYITYRLV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 177/209 (85%)
polr2eNP_001016473.1 PLN03111 1..209 CDD:215582 175/207 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2018
Inparanoid 1 1.050 327 1.000 Inparanoid score I2434
OMA 1 1.010 - - QHG54766
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 1 1.000 - - FOG0003717
OrthoInspector 1 1.000 - - oto104302
Panther 1 1.100 - - LDO PTHR10535
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1175
SonicParanoid 1 1.000 - - X3076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.