DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and POLR2E

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_011526372.1 Gene:POLR2E / 5434 HGNCID:9192 Length:211 Species:Homo sapiens


Alignment Length:210 Identity:178/210 - (84%)
Similarity:190/210 - (90%) Gaps:1/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHN 65
            ||||.|||:||:||||||||.|||||||||||||||||:||...||||||.||.|:||.||||||
Human     1 MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHN 65

  Fly    66 DDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQF 130
            ||||||||||||||||:||||||.||.|||||||.||::|||.||||||||||||||||||||||
Human    66 DDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQF 130

  Fly   131 LESELLINITEHELVPEHVVMTVEEKQELLSRY-KLKENMLMRIQAGDPVARYFGLKRGQVVKII 194
            |:.|||||||||||||||||||.||..|||:|| ||:||.|.|||||||||||||:|||||||||
Human   131 LQQELLINITEHELVPEHVVMTKEEVTELLARYSKLRENQLPRIQAGDPVARYFGIKRGQVVKII 195

  Fly   195 RSSETAGRYISYRLV 209
            |.||||||||:||||
Human   196 RPSETAGRYITYRLV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 178/210 (85%)
POLR2EXP_011526372.1 PLN03111 1..210 CDD:215582 176/208 (85%)
RNA_pol_Rpb5_N 4..92 CDD:281816 73/87 (84%)
RNA_pol_Rpb5_C 138..210 CDD:279524 60/71 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153169
Domainoid 1 1.000 161 1.000 Domainoid score I4039
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2018
Inparanoid 1 1.050 360 1.000 Inparanoid score I2212
Isobase 1 0.950 - 0 Normalized mean entropy S297
OMA 1 1.010 - - QHG54766
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 1 1.000 - - FOG0003717
OrthoInspector 1 1.000 - - oto90503
orthoMCL 1 0.900 - - OOG6_101049
Panther 1 1.100 - - LDO PTHR10535
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1175
SonicParanoid 1 1.000 - - X3076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.