DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and polr2eb

DIOPT Version :9

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001003564.1 Gene:polr2eb / 445170 ZFINID:ZDB-GENE-040801-83 Length:210 Species:Danio rerio


Alignment Length:209 Identity:178/209 - (85%)
Similarity:191/209 - (91%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHN 65
            ||||.|||:||:||||||||.||||||||||||||||::|:..|||||||.||.|:||.||||||
Zfish     1 MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLDEFRSQFGDKPSEGRPRRNDLTVLVAHN 65

  Fly    66 DDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQF 130
            ||||||||||||||||:||||||.||.|||||||.|||:|||.||||||||||||||||||||||
Zfish    66 DDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRAIIVVQMGMTPSAKQSLVDMAPKYILEQF 130

  Fly   131 LESELLINITEHELVPEHVVMTVEEKQELLSRYKLKENMLMRIQAGDPVARYFGLKRGQVVKIIR 195
            |:.|||||||||||||||:|||.||..|||:||||||:.|.||||||||||||||||||||||||
Zfish   131 LQQELLINITEHELVPEHIVMTKEEVTELLARYKLKESQLPRIQAGDPVARYFGLKRGQVVKIIR 195

  Fly   196 SSETAGRYISYRLV 209
            .||||||||:||||
Zfish   196 PSETAGRYITYRLV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 178/209 (85%)
polr2ebNP_001003564.1 PLN03111 1..209 CDD:215582 176/207 (85%)
RNA_pol_Rpb5_N 4..92 CDD:281816 72/87 (83%)
RNA_pol_Rpb5_C 138..209 CDD:279524 60/70 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588229
Domainoid 1 1.000 162 1.000 Domainoid score I3957
eggNOG 1 0.900 - - E1_COG2012
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2018
Inparanoid 1 1.050 361 1.000 Inparanoid score I2163
OMA 1 1.010 - - QHG54766
OrthoDB 1 1.010 - - D1255823at2759
OrthoFinder 1 1.000 - - FOG0003717
OrthoInspector 1 1.000 - - otm25095
orthoMCL 1 0.900 - - OOG6_101049
Panther 1 1.100 - - LDO PTHR10535
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1175
SonicParanoid 1 1.000 - - X3076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.