DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14 and Ndufa6

DIOPT Version :9

Sequence 1:NP_001260877.1 Gene:ND-B14 / 36159 FlyBaseID:FBgn0033570 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_080263.1 Gene:Ndufa6 / 67130 MGIID:1914380 Length:131 Species:Mus musculus


Alignment Length:117 Identity:59/117 - (50%)
Similarity:87/117 - (74%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVKRAVQQVRPILSVDREEARKRALNLYKAWYRQIPYIVMDYDIPMTVEQCRDKLREEFVKHRNV 70
            |...|...|:||.|.|..||::|...||:||||::|..|....:.:||:|.|||:||.|:|:.:|
Mouse    12 AAAAASTSVKPIFSRDLNEAKRRVRELYRAWYREVPNTVHLMQLDITVKQGRDKVREMFMKNAHV 76

  Fly    71 TDIRVIDMLVIKGQMELKESVEIWKQKGHIMRYWKESQDPKPTDFLSKFIQG 122
            ||.||:|:|||||:|||:|::::|||:.|:||::.|::.|:|.||||||..|
Mouse    77 TDPRVVDLLVIKGKMELQETIKVWKQRTHVMRFFHETETPRPKDFLSKFYMG 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14NP_001260877.1 Complex1_LYR_NDUFA6_LYRM6 22..96 CDD:380761 37/73 (51%)
Ndufa6NP_080263.1 Complex1_LYR_NDUFA6_LYRM6 28..102 CDD:380761 37/73 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847081
Domainoid 1 1.000 74 1.000 Domainoid score I9163
eggNOG 1 0.900 - - E1_KOG3426
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1861
Inparanoid 1 1.050 130 1.000 Inparanoid score I4622
Isobase 1 0.950 - 0 Normalized mean entropy S3953
OMA 1 1.010 - - QHG59186
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005626
OrthoInspector 1 1.000 - - oto91905
orthoMCL 1 0.900 - - OOG6_103406
Panther 1 1.100 - - LDO PTHR12964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3516
SonicParanoid 1 1.000 - - X4602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.