DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14 and ndufa6

DIOPT Version :9

Sequence 1:NP_001260877.1 Gene:ND-B14 / 36159 FlyBaseID:FBgn0033570 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001017354.1 Gene:ndufa6 / 550108 XenbaseID:XB-GENE-1002262 Length:127 Species:Xenopus tropicalis


Alignment Length:117 Identity:66/117 - (56%)
Similarity:90/117 - (76%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVKRAVQQVRPILSVDREEARKRALNLYKAWYRQIPYIVMDYDIPMTVEQCRDKLREEFVKHRNV 70
            |..||...|:||||.|..||::|..:||:||||::|..|..:.:.:||:|.|||:||.|.|:.:|
 Frog     8 ATARAAAAVKPILSRDLGEAKRRVRDLYRAWYREVPNSVHVFQLDITVKQGRDKVREMFQKNAHV 72

  Fly    71 TDIRVIDMLVIKGQMELKESVEIWKQKGHIMRYWKESQDPKPTDFLSKFIQG 122
            ||.||||||||||:|||:|::.:|||:.|||||:.|::.|:||||||||..|
 Frog    73 TDPRVIDMLVIKGKMELQETINVWKQRTHIMRYFHETETPRPTDFLSKFYVG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14NP_001260877.1 Complex1_LYR_NDUFA6_LYRM6 22..96 CDD:380761 39/73 (53%)
ndufa6NP_001017354.1 Complex1_LYR_NDUFA6_LYRM6 24..98 CDD:380761 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9821
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1861
Inparanoid 1 1.050 83 1.000 Inparanoid score I5026
OMA 1 1.010 - - QHG59186
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005626
OrthoInspector 1 1.000 - - oto102217
Panther 1 1.100 - - LDO PTHR12964
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.