DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14 and NDUFA6

DIOPT Version :9

Sequence 1:NP_001260877.1 Gene:ND-B14 / 36159 FlyBaseID:FBgn0033570 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_002481.3 Gene:NDUFA6 / 4700 HGNCID:7690 Length:128 Species:Homo sapiens


Alignment Length:125 Identity:61/125 - (48%)
Similarity:92/125 - (73%) Gaps:3/125 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAG---REAVKRAVQQVRPILSVDREEARKRALNLYKAWYRQIPYIVMDYDIPMTVEQCRDKLRE 62
            |||   |:|...|...|:||.|.|..||::|...||:||||::|..|..:.:.:||:..|||:||
Human     1 MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVRE 65

  Fly    63 EFVKHRNVTDIRVIDMLVIKGQMELKESVEIWKQKGHIMRYWKESQDPKPTDFLSKFIQG 122
            .|:|:.:|||.||:|:|||||::||:|::::|||:.|:||::.|::.|:|.||||||..|
Human    66 MFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14NP_001260877.1 Complex1_LYR_NDUFA6_LYRM6 22..96 CDD:380761 35/73 (48%)
NDUFA6NP_002481.3 Complex1_LYR 30..92 CDD:310152 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156671
Domainoid 1 1.000 71 1.000 Domainoid score I9476
eggNOG 1 0.900 - - E1_KOG3426
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1861
Inparanoid 1 1.050 131 1.000 Inparanoid score I4639
Isobase 1 0.950 - 0 Normalized mean entropy S3953
OMA 1 1.010 - - QHG59186
OrthoDB 1 1.010 - - D1518948at2759
OrthoFinder 1 1.000 - - FOG0005626
OrthoInspector 1 1.000 - - oto88332
orthoMCL 1 0.900 - - OOG6_103406
Panther 1 1.100 - - LDO PTHR12964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3516
SonicParanoid 1 1.000 - - X4602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.