DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdelr1 and KdelR

DIOPT Version :9

Sequence 1:NP_001017385.1 Gene:Kdelr1 / 361577 RGDID:1306764 Length:212 Species:Rattus norvegicus
Sequence 2:NP_477296.1 Gene:KdelR / 34427 FlyBaseID:FBgn0267330 Length:212 Species:Drosophila melanogaster


Alignment Length:212 Identity:158/212 - (74%)
Similarity:189/212 - (89%) Gaps:0/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYNTCMKV 65
            ||:|||.|||||:.|||:|||||||:|||||||||||:|||||:..|||||||.|:||||:.|||
  Fly     1 MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLDLFTTYVSLYNSVMKV 65

  Rat    66 VYIACSFTTVWMIYSKFKATYDGNHDTFRVEFLVVPTAVLAFLVNHDFTPLEILWTFSIYLESVA 130
            :::|.|..||:::|.|||||||.|||:||:|||:||.|:|:.::||:||.:|:||||||||||||
  Fly    66 LFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLVPCALLSLVINHEFTVMEVLWTFSIYLESVA 130

  Rat   131 ILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFF 195
            ||||||:||:|||||:||||||||||.||.|||.||::||..|..:|||||.||:||||||||||
  Fly   131 ILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDFF 195

  Rat   196 YLYITKVLKGKKLSLPA 212
            |||||||||||||.|||
  Fly   196 YLYITKVLKGKKLQLPA 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Kdelr1NP_001017385.1 ER_lumen_recept 28..169 CDD:395652 101/140 (72%)