DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and TIGD7

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_149985.2 Gene:TIGD7 / 91151 HGNCID:18331 Length:549 Species:Homo sapiens


Alignment Length:217 Identity:52/217 - (23%)
Similarity:98/217 - (45%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKL--NQMRRN 73
            |:|.|||||:|:...|..: |::.:...|.|.|:...||.|:|:.|.:.:|..::.|  .:.|:.
Human     8 TTLNLEEKMKVLSRIEAGR-SLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRKR 71

  Fly    74 PLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNVR 138
            ....:...:|:..:.|:.:.|:..:|:.|..::..|::.|...|.::|.||:|||.::|.||   
Human    72 TTGAKYGDVDDAVYMWYQQKRSAGVPVRGVELQAAAERFARCFGRTDFKASTGWLFRFRNRH--- 133

  Fly   139 YNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDDYASY 203
                                 .|.|:..|.|    .::..:....|...|  :|....|::....
Human   134 ---------------------AIGNRKGCGE----QVLSSVSENVEPFRQ--KLSMIIKEEKLCL 171

  Fly   204 QQLISLENQWSWKWNIFKKELP 225
            .||.|.:     :.::|.|.:|
Human   172 AQLYSGD-----ETDLFWKSMP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 18/48 (38%)
CENPB 78..141 CDD:197828 17/62 (27%)
TIGD7NP_149985.2 HTH 4..55 CDD:328727 18/47 (38%)
HTH_Tnp_Tc5 77..135 CDD:308705 17/81 (21%)
rve 207..399 CDD:328789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 527..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.