DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and JRK

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_003715.3 Gene:JRK / 8629 HGNCID:6199 Length:568 Species:Homo sapiens


Alignment Length:179 Identity:47/179 - (26%)
Similarity:87/179 - (48%) Gaps:18/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGEL-KL 67
            |..|| |..|||:||:::....|:.: |.:.|.:.:|:|.:...||..||..:.....|.:. |.
Human    12 GEKRK-RVVLTLKEKIDICTRLEKGE-SRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKA 74

  Fly    68 NQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSA-SSGWLEKW 131
            .:.||...:.:...:|.:.::||...|:|.:|:||.|:.:|||....::..:.... |.|||.::
Human    75 LEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQLTEPCVFSGGWLWRF 139

  Fly   132 RKRHNVRYND------TGDSLDLQEFEAIL--------VKSEPISNKDD 166
            :.||.::..|      :.|....::|.|..        :.:|.:.|.|:
Human   140 KARHGIKKLDASSEKQSADHQAAEQFCAFFRSLAAEHGLSAEQVYNADE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/52 (33%)
CENPB 78..141 CDD:197828 18/63 (29%)
JRKNP_003715.3 CENP-B_N 14..66 CDD:282122 17/53 (32%)
CENPB 83..147 CDD:197828 18/63 (29%)
DDE_1 213..382 CDD:281213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm40429
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.