DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and PDC2

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_010366.1 Gene:PDC2 / 851654 SGDID:S000002488 Length:925 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:39/217 - (17%)
Similarity:88/217 - (40%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTLEEKMEVIQSQERN-KLSVRDLAK----RFNIGKTQAADILKH---KQSIKEGLLSGELKLNQ 69
            |:::::..:....||: |.:..:|||    .|.:.|..:...:..   ::|........|...|:
Yeast     2 LSIQQRYNICLMAERHPKWTQLELAKWAYETFQLPKIPSQGTISRLLARKSTYMNCKEHEKDANR 66

  Fly    70 MRR-NPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAK----QLAVELGHSNFSASSGWLE 129
            :|: |.|..|     ::..:|.|:.....|||:..:::..|:    ::..|....|.|.|..|:.
Yeast    67 LRKPNNLLVR-----KILQEWISQSLWNGIPITSPIIQDTAQAVWHRIPAEHREGNGSFSYKWIS 126

  Fly   130 KWRKRHNVRYNDTGDSL-------DLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMM 187
            .:..:.:|..:...:.|       ..:|.:.:......|..||             :::.:||.:
Yeast   127 NFLSKMDVNISVLDEELPKTPKVWTFEERDVLKAYFSKIPPKD-------------LFTLDEAFL 178

  Fly   188 QLARLKEFAKDDYASYQQLISL 209
            ......::|:.:.:|.|:.|.:
Yeast   179 SYNLPLDYAQYEASSIQRRIEV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 10/54 (19%)
CENPB 78..141 CDD:197828 13/66 (20%)
PDC2NP_010366.1 HTH_Tnp_Tc5 72..135 CDD:397365 13/67 (19%)
DDE_1 198..406 CDD:367380 1/3 (33%)
PLN02217 <716..829 CDD:215130
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.